RetrogeneDB ID: | retro_ecab_172 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 1:67965941..67966179(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | GNB2L1 | ||
| Ensembl ID: | ENSECAG00000022567 | ||
| Aliases: | None | ||
| Description: | guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 [Source:RefSeq peptide;Acc:NP_001229375] |
| Percent Identity: | 75.31 % |
| Parental protein coverage: | 53.33 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | LNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGP-SIKIWDLEG |
| L.TVTVSPDGSLCASGGKDGQA.L.DLN.GKHLYTL.GGDIIN.LCFS...YWL....GP..IK.WDLEG | |
| Retrocopy | LYTVTVSPDGSLCASGGKDGQARLKDLNKGKHLYTLEGGDIINTLCFSLSHYWL-HCHGP>GIKVWDLEG |
| Parental | KIIVDELKQEV |
| K..VDE.KQE. | |
| Retrocopy | KVAVDEPKQEI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .71 RPM | 699 .21 RPM |
| SRP021940_cerebellum | 0 .10 RPM | 258 .05 RPM |
| SRP021940_embryo | 0 .41 RPM | 518 .00 RPM |
| SRP021940_placental_villous | 0 .19 RPM | 300 .94 RPM |
| SRP021940_synovial_membrane | 0 .77 RPM | 488 .51 RPM |
| SRP021940_testis | 0 .00 RPM | 252 .64 RPM |