RetrogeneDB ID: | retro_dord_762 | ||
Retrocopylocation | Organism: | Kangaroo rat (Dipodomys ordii) | |
| Coordinates: | scaffold_81286:3440..3679(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Isca2 | ||
| Ensembl ID: | ENSDORG00000014857 | ||
| Aliases: | None | ||
| Description: | iron-sulfur cluster assembly 2 homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1921566] |
| Percent Identity: | 71.6 % |
| Parental protein coverage: | 51.95 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | SPIAAAALRAAIPW-RRSRILLISPGLQRRWDASSSNSEAGEEQIRLTDSCVRRLLEITEGSEFLRLQVE |
| S...A.AL...IP..RRSR.LLI.PGLQR.WDAS.SNSEA.E.Q....DSCVRRLLEITEGSEFLRLQVE | |
| Retrocopy | SGLRAVALQVVIPC<RRSRFLLIFPGLQRHWDASPSNSEASEAQTHFMDSCVRRLLEITEGSEFLRLQVE |
| Parental | GGGCSGFQYKF |
| GG.CSGFQ... | |
| Retrocopy | GGACSGFQSSY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000020479 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000014857 | 1 retrocopy |
retro_dord_762 ,
|
| Gorilla gorilla | ENSGGOG00000012894 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006566 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016268 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000011684 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000006536 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012085 | 1 retrocopy |