RetrogeneDB ID: | retro_dord_602 | ||
Retrocopylocation | Organism: | Kangaroo rat (Dipodomys ordii) | |
| Coordinates: | scaffold_39525:4850..5266(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Ranbp1 | ||
| Ensembl ID: | ENSDORG00000011317 | ||
| Aliases: | None | ||
| Description: | RAN binding protein 1 [Source:MGI Symbol;Acc:MGI:96269] |
| Percent Identity: | 68.06 % |
| Parental protein coverage: | 70.1 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | NDLPEWKERGTGDVKLLKHKEKGTIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAWVWNTHADFADE |
| .DL.EWKE.GTG...LLKH.EKGT.RL.MRRDKTLKI..NHYIT..MELK.N..S...WVW.THA.F.D. | |
| Retrocopy | DDLSEWKE*GTGNGNLLKHQEKGTMRLFMRRDKTLKIHVNHYITLVMELKLNTNS--VWVWKTHAHFTDR |
| Parental | CPKPELLAIRFLNAENAQKFKTKFEECRKEIEERDKKAGPGKNDNAEKVAEKLEAL-SVKEAGDKVEEKS |
| C.KPELLAI.FLN...AQKFKT.FEECRKEIE....K..PGKN.NAEK.AEKLE...SV.EA.D...EK. | |
| Retrocopy | CLKPELLAIHFLNVKSAQKFKTTFEECRKEIEK--EKK*PGKNYNAEKEAEKLEDV<SVMEARDVGKEKR |
| Parental | EEKQ |
| EEKQ | |
| Retrocopy | EEKQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000010749 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000002962 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000011317 | 2 retrocopies |
retro_dord_241, retro_dord_602 ,
|
| Echinops telfairi | ENSETEG00000015996 | 2 retrocopies | |
| Homo sapiens | ENSG00000099901 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000784 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016620 | 8 retrocopies | |
| Myotis lucifugus | ENSMLUG00000017535 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020100 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000010312 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000005732 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005684 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000034333 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000011593 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000001884 | 4 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000006873 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000026840 | 2 retrocopies |