RetrogeneDB ID: | retro_dnov_963 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_127737:3126..3364(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS12 | ||
| Ensembl ID: | ENSDNOG00000006214 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S12 [Source:HGNC Symbol;Acc:10385] |
| Percent Identity: | 68.29 % |
| Parental protein coverage: | 60.61 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | LASNCDEPMYVKLVEAL-CAEHQINLIKVDDNKKLGEWVGLCKIDREG-KPRKVVGCSCVVVKDYGKESQ |
| LASNC.E..YVKL...L.CAEHQINLIK.DDNKK.GE.V.LC...REG.K..K.VG.SC..VKDY.KE.. | |
| Retrocopy | LASNCNESVYVKLLQSL<CAEHQINLIKIDDNKKPGE*VDLCETNREG<KRGKLVGFSCMTVKDYSKEAR |
| Parental | AKDVIEEYFKCK |
| A.DVIEEY.KCK | |
| Retrocopy | AQDVIEEYYKCK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 459 .72 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 187 .65 RPM |
| SRP012922_heart | 0 .00 RPM | 177 .27 RPM |
| SRP012922_kidney | 0 .00 RPM | 489 .27 RPM |
| SRP012922_liver | 0 .00 RPM | 206 .82 RPM |
| SRP012922_lung | 0 .00 RPM | 592 .11 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 224 .66 RPM |
| SRP012922_spleen | 0 .00 RPM | 856 .74 RPM |