RetrogeneDB ID: | retro_dnov_794 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_108344:2169..2583(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CBX3 | ||
| Ensembl ID: | ENSDNOG00000006250 | ||
| Aliases: | None | ||
| Description: | chromobox homolog 3 [Source:HGNC Symbol;Acc:1553] |
| Percent Identity: | 54.79 % |
| Parental protein coverage: | 78.14 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 3 |
| Parental | KKVEEAEPEEFV-VEKVLDRR-VVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKA-GKEK |
| ..V...E.EE.V.VEK.L....VVNG.VEY....KGF.D.DNTWEPEENLDCP.LI..FL.SQK...K.K | |
| Retrocopy | EEVQQEEEEESV<VEKFLSVQ<VVNGQVEYLYEVKGFSDEDNTWEPEENLDCPDLIAEFLQSQKT<SKHK |
| Parental | DGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEA |
| .....K..........K........D....F.RGL..E..IGATDS.GELMFLMK.K.SDEADLV.AKE. | |
| Retrocopy | ADSDSKDKGKGNKSKKKKEELEKSQD----FVRGLELEQVIGATDSRGELMFLMK*KNSDEADLVPAKEG |
| Parental | NMKCPQ |
| N.KCPQ | |
| Retrocopy | NAKCPQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 32 .48 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 44 .68 RPM |
| SRP012922_heart | 0 .00 RPM | 30 .16 RPM |
| SRP012922_kidney | 0 .00 RPM | 21 .08 RPM |
| SRP012922_liver | 0 .00 RPM | 38 .08 RPM |
| SRP012922_lung | 0 .00 RPM | 57 .88 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 23 .71 RPM |
| SRP012922_spleen | 0 .00 RPM | 65 .13 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000006250 | 19 retrocopies |
retro_dnov_1136, retro_dnov_1174, retro_dnov_1208, retro_dnov_1270, retro_dnov_1605, retro_dnov_2306, retro_dnov_2307, retro_dnov_2397, retro_dnov_2543, retro_dnov_2605, retro_dnov_2633, retro_dnov_321, retro_dnov_359, retro_dnov_385, retro_dnov_445, retro_dnov_772, retro_dnov_794 , retro_dnov_833, retro_dnov_844,
|
| Felis catus | ENSFCAG00000015224 | 6 retrocopies | |
| Microcebus murinus | ENSMICG00000006998 | 11 retrocopies | |
| Ochotona princeps | ENSOPRG00000011713 | 9 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000017913 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000016711 | 4 retrocopies |