RetrogeneDB ID: | retro_dnov_674 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_751:85843..86154(+) | ||
| Located in intron of: | ENSDNOG00000012866 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MNF1 | ||
| Ensembl ID: | ENSDNOG00000002019 | ||
| Aliases: | None | ||
| Description: | mitochondrial nucleoid factor 1 [Source:HGNC Symbol;Acc:21237] |
| Percent Identity: | 54.13 % |
| Parental protein coverage: | 82.93 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 4 |
| Parental | FLKLCEEWPVDETK-RGRDLGVDLRQRVAQAFREGENT-QIAEPEACDQMYESLARLHSNYYK-HKYPRP |
| F..LCEEW..DETK..G..LG......V.QAF.EGE.T.QIAE..A.D...ESL..LHSNYYK..KYP.. | |
| Retrocopy | FPELCEEWLMDETK<MGLGLGAPPQ*GVVQAFWEGEST<QIAELRAYD*RHESLT*LHSNYYK<TKYPHL |
| Parental | RDTSFSGLSV-EEYKLVLATDTKEFK---KDKMKKLQEK |
| RDT.FSGL...E...........EFK...KD..KKLQEK | |
| Retrocopy | RDTCFSGLMM<EPQLILSTDTLEEFKEMNKDTWKKLQEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 35 .20 RPM |
| SRP012922_cerebellum | 0 .41 RPM | 27 .36 RPM |
| SRP012922_heart | 0 .23 RPM | 50 .58 RPM |
| SRP012922_kidney | 0 .00 RPM | 43 .53 RPM |
| SRP012922_liver | 0 .00 RPM | 17 .49 RPM |
| SRP012922_lung | 0 .31 RPM | 18 .63 RPM |
| SRP012922_quadricep_muscle | 0 .17 RPM | 52 .27 RPM |
| SRP012922_spleen | 0 .11 RPM | 25 .18 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000031270 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000002019 | 1 retrocopy |
retro_dnov_674 ,
|
| Echinops telfairi | ENSETEG00000006979 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000005278 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000013996 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000003032 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024208 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000015604 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000001380 | 6 retrocopies |