RetrogeneDB ID: | retro_dnov_2389 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_70032:4997..5373(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | STARD3NL | ||
| Ensembl ID: | ENSDNOG00000017960 | ||
| Aliases: | None | ||
| Description: | STARD3 N-terminal like [Source:HGNC Symbol;Acc:19169] |
| Percent Identity: | 83.46 % |
| Parental protein coverage: | 53.62 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | LFVTFDLLFVTLLWIIELNVNGGIENTLEKEVVHYDYYSSYFDIFLLAVFRFKVLILAYAVCKLRHWWAI |
| LFVTFDLLFVTLL.IIE.NVNGGIENTLEK.VVH..Y.SSYFDIF...VF.FK.LI.AYAVCKL.HWWAI | |
| Retrocopy | LFVTFDLLFVTLLQIIEVNVNGGIENTLEK-VVHDNYCSSYFDIFIFTVFQFKILIHAYAVCKLSHWWAI |
| Parental | ALTTAVTSAFLLAKVILSKLFSQGAFGYVLPIISF-ILAWIETWFLDFKVLPQEAEE |
| .L.TAV..AFLLAK..LSKLFSQGAFGYVLPIISF.IL.WIETWFLDFKVLPQEAEE | |
| Retrocopy | VLMTAVITAFLLAKTVLSKLFSQGAFGYVLPIISF>ILTWIETWFLDFKVLPQEAEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 10 .89 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 13 .33 RPM |
| SRP012922_heart | 0 .00 RPM | 3 .48 RPM |
| SRP012922_kidney | 0 .27 RPM | 12 .59 RPM |
| SRP012922_liver | 0 .15 RPM | 4 .80 RPM |
| SRP012922_lung | 0 .15 RPM | 10 .69 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 1 .21 RPM |
| SRP012922_spleen | 0 .11 RPM | 18 .89 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000038795 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000008990 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000012622 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000004394 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017960 | 1 retrocopy |
retro_dnov_2389 ,
|
| Equus caballus | ENSECAG00000005250 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000000945 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000023659 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014750 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004099 | 1 retrocopy |