RetrogeneDB ID: | retro_dnov_2139 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_50765:12794..13027(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MPC1 | ||
| Ensembl ID: | ENSDNOG00000001205 | ||
| Aliases: | None | ||
| Description: | mitochondrial pyruvate carrier 1 [Source:HGNC Symbol;Acc:21606] |
| Percent Identity: | 77.22 % |
| Parental protein coverage: | 71.96 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | AGALVRKAADYVRSKEF-RDYLMS-HFWGPVANWGLPIAAINDMNKSPEIISGRMTFALCCYSVAFMRFA |
| AGAL.R.AAD.V..KE..RDYL.S.HFWGPVANW..P.AAIND..KSPE.ISGRMTFALCCYS..F.RFA | |
| Retrocopy | AGALGREAADCVPRKEL<RDYLLSMHFWGPVANWVPPTAAINDRKKSPEMISGRMTFALCCYSSTFLRFA |
| Parental | YKVQPRNWL |
| YKVQPRNWL | |
| Retrocopy | YKVQPRNWL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 17 .11 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 29 .01 RPM |
| SRP012922_heart | 0 .00 RPM | 99 .54 RPM |
| SRP012922_kidney | 0 .00 RPM | 105 .96 RPM |
| SRP012922_liver | 0 .00 RPM | 33 .75 RPM |
| SRP012922_lung | 0 .00 RPM | 47 .65 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 180 .53 RPM |
| SRP012922_spleen | 0 .00 RPM | 18 .08 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000027879 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000012552 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000001205 | 1 retrocopy |
retro_dnov_2139 ,
|
| Homo sapiens | ENSG00000060762 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000000583 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000023861 | 3 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000004153 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000017166 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012415 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000004456 | 1 retrocopy |