RetrogeneDB ID: | retro_dnov_1746 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_2854:66924..67116(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSDNOG00000025274 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SERP1 | ||
| Ensembl ID: | ENSDNOG00000013995 | ||
| Aliases: | None | ||
| Description: | stress-associated endoplasmic reticulum protein 1 [Source:HGNC Symbol;Acc:10759] |
| Percent Identity: | 57.35 % |
| Parental protein coverage: | 98.48 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 3 |
| Parental | MVAKQRIRMANEKHSKNIT-QRGNVAKTSRNA-PEEK-ASVGPWLLALFIFVVCGSAIFQIIQSIRMG |
| .VA.Q.I..A.EK.SK....QRG..A.T...A.P.EK.A.VG.W.LA.F.FVVCG.A..QIIQS.RMG | |
| Retrocopy | VVAEQQIPRAKEKQSKSTP<QRGDEATTLGKA<PREK<AAVGHWSLACFVFVVCGAATPQIIQSVRMG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 43 .76 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 11 .96 RPM |
| SRP012922_heart | 0 .00 RPM | 2 .78 RPM |
| SRP012922_kidney | 0 .00 RPM | 18 .62 RPM |
| SRP012922_liver | 0 .00 RPM | 33 .28 RPM |
| SRP012922_lung | 0 .00 RPM | 49 .18 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 1 .21 RPM |
| SRP012922_spleen | 0 .00 RPM | 55 .06 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000013995 | 15 retrocopies | |
| Microcebus murinus | ENSMICG00000000414 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016085 | 2 retrocopies |