RetrogeneDB ID: | retro_dnov_1616 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_24758:83100..83503(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TSPAN3 | ||
| Ensembl ID: | ENSDNOG00000005619 | ||
| Aliases: | None | ||
| Description: | tetraspanin 3 [Source:HGNC Symbol;Acc:17752] |
| Percent Identity: | 87.59 % |
| Parental protein coverage: | 53.36 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | IQKVYKTYNGTSPDAASRAIDYVQRQLHC-CGIHNYSDWENTDWFKETKNQSVPLSCCRDTAISCNGSLA |
| ..K.YKTY.GT.PDAASRAIDYVQ.QLH..CGIHNYSDWENTD.FKETK.QSVPLSCCRDTAISCNGSLA | |
| Retrocopy | LMKLYKTYKGTNPDAASRAIDYVQKQLHV<CGIHNYSDWENTD*FKETKIQSVPLSCCRDTAISCNGSLA |
| Parental | HPSDLYAEG-CEALVVKKLQEIMMHVIWAALAFAAIQLLGMLCACIVLCRRSRDPAYELLITGGTYA |
| HPSD.YAEG.CEALV.KKLQEIMMHVIWAALAFAAIQLLGMLCACIVLCRR.R.PAYELLI.G.TYA | |
| Retrocopy | HPSDVYAEG<CEALVLKKLQEIMMHVIWAALAFAAIQLLGMLCACIVLCRRRRNPAYELLIIGRTYA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 127 .77 RPM |
| SRP012922_cerebellum | 0 .14 RPM | 143 .93 RPM |
| SRP012922_heart | 0 .00 RPM | 39 .21 RPM |
| SRP012922_kidney | 0 .00 RPM | 192 .75 RPM |
| SRP012922_liver | 0 .15 RPM | 71 .83 RPM |
| SRP012922_lung | 0 .00 RPM | 132 .72 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 105 .75 RPM |
| SRP012922_spleen | 0 .00 RPM | 91 .23 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009727 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000002415 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000018068 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000003785 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000005619 | 3 retrocopies |
retro_dnov_1371, retro_dnov_1520, retro_dnov_1616 ,
|
| Echinops telfairi | ENSETEG00000010916 | 1 retrocopy | |
| Felis catus | ENSFCAG00000025746 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000017332 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000004662 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000005615 | 1 retrocopy |