RetrogeneDB ID: | retro_dnov_1464 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_20856:26169..26369(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPLP2 | ||
| Ensembl ID: | ENSDNOG00000011513 | ||
| Aliases: | None | ||
| Description: | ribosomal protein, large, P2 [Source:HGNC Symbol;Acc:10377] |
| Percent Identity: | 75. % |
| Parental protein coverage: | 95.95 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | VISELNGKNIEDVIAQGIGKLASVPAGGAVAVA-AAPGSAAPAASSAPAAAEEKKDEKKEESEESDDDMG |
| VISELNGKNIED.IA.GI.KLAS.PAGG.VAVA....GSAA.AASSAPAAAEEKK.E....SEE.D..MG | |
| Retrocopy | VISELNGKNIEDGIAKGIRKLASMPAGGPVAVA<PTLGSAARAASSAPAAAEEKKEE----SEELDNNMG |
| Parental | FG |
| FG | |
| Retrocopy | FG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .19 RPM | 146 .43 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 56 .09 RPM |
| SRP012922_heart | 0 .23 RPM | 86 .78 RPM |
| SRP012922_kidney | 0 .82 RPM | 148 .40 RPM |
| SRP012922_liver | 0 .00 RPM | 63 .47 RPM |
| SRP012922_lung | 0 .92 RPM | 186 .17 RPM |
| SRP012922_quadricep_muscle | 0 .69 RPM | 121 .68 RPM |
| SRP012922_spleen | 0 .23 RPM | 181 .08 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000001777 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000009523 | 1 retrocopy | |
| Ciona intestinalis | ENSCING00000000626 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000011513 | 12 retrocopies | |
| Felis catus | ENSFCAG00000008417 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020627 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000026860 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016296 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000002116 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000001056 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000012842 | 1 retrocopy |