RetrogeneDB ID: | retro_dnov_1023 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_13692:59816..60037(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNAPIN | ||
| Ensembl ID: | ENSDNOG00000015216 | ||
| Aliases: | None | ||
| Description: | SNAP-associated protein [Source:HGNC Symbol;Acc:17145] |
| Percent Identity: | 69.33 % |
| Parental protein coverage: | 54.41 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MAGAGSAAVSGAGTPVTVPVGRDLFAEG-LLEFLRPAVQQLDSHVHAVRESQVELREHIDNLATELCRIN |
| MAG..SA.VS.A.T.V.V.VG.DLF..G.LLEFLRPAVQQL.SHVH..RESQVEL.EHI.N..TELC.I. | |
| Retrocopy | MAGTVSAGVSAARTQVAVAVGCDLFLRG<LLEFLRPAVQQLNSHVHTIRESQVELWEHINNITTELCHIS |
| Parental | EDQKV |
| E.QK. | |
| Retrocopy | EVQKM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 10 .89 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 20 .48 RPM |
| SRP012922_heart | 0 .00 RPM | 21 .11 RPM |
| SRP012922_kidney | 0 .00 RPM | 15 .61 RPM |
| SRP012922_liver | 0 .00 RPM | 8 .05 RPM |
| SRP012922_lung | 0 .00 RPM | 20 .47 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 24 .23 RPM |
| SRP012922_spleen | 0 .00 RPM | 24 .95 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000003301 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000010373 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000015216 | 1 retrocopy |
retro_dnov_1023 ,
|
| Mus musculus | ENSMUSG00000001018 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000013451 | 1 retrocopy |