RetrogeneDB ID: | retro_cpor_971 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_37:18981520..18981749(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS18 | ||
| Ensembl ID: | ENSCPOG00000019675 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.09 % |
| Parental protein coverage: | 50.66 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | AHVVLRKADIDLTKRAG-ELTEDE-VERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLR |
| A..VLRKA..DLTK.A..ELTE.E.....I...QNPRQ.KIPDWF.NRQKD.K.GKYSQVL.NGLD.KLR | |
| Retrocopy | ARGVLRKAAVDLTKGAQ<ELTEEE<MQCGIAVVQNPRQHKIPDWFPNRQKDAKGGKYSQVLSNGLDSKLR |
| Parental | EDLERLKKI |
| .DL...KKI | |
| Retrocopy | KDLG*PKKI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 122 .17 RPM |
| SRP017611_kidney | 0 .00 RPM | 218 .69 RPM |
| SRP017611_liver | 0 .00 RPM | 128 .32 RPM |
| SRP040447_lung | 0 .00 RPM | 288 .00 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 328 .03 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000002918 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000001623 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000019675 | 4 retrocopies | |
| Felis catus | ENSFCAG00000004013 | 7 retrocopies | |
| Gorilla gorilla | ENSGGOG00000006571 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000032173 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007360 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000003867 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000002306 | 6 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010546 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025953 | 14 retrocopies | |
| Pan troglodytes | ENSPTRG00000018039 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000028505 | 4 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000006857 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000008658 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002417 | 13 retrocopies |