RetrogeneDB ID: | retro_cpor_890 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_32:5649488..5649894(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HMGB2 | ||
| Ensembl ID: | ENSCPOG00000003552 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 84.78 % |
| Parental protein coverage: | 64.45 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | PDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMK-NYVPPKGGDKRGKKKDPNAPKRPP |
| PD.SVN..EFSKKCSERWKTM.AKEKSKFEDMA.SDK...DREMK.N.VPPKGGDKRGKKKD.NAP.RPP | |
| Retrocopy | PDFSVNLVEFSKKCSERWKTMAAKEKSKFEDMAESDKVLHDREMK<NHVPPKGGDKRGKKKDCNAPERPP |
| Parental | SAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKL-KEKYEKDIAAYRAKG |
| SAFFLF.SEHRPKIKSEHPGLSIGDTAKKLG.M.SE.SAKDKQPYEQKAAKL.KEK.EKDIA...AKG | |
| Retrocopy | SAFFLFHSEHRPKIKSEHPGLSIGDTAKKLGGMRSEASAKDKQPYEQKAAKL<KEKQEKDIAVHQAKG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 6 .67 RPM |
| SRP017611_kidney | 0 .00 RPM | 16 .96 RPM |
| SRP017611_liver | 0 .00 RPM | 9 .10 RPM |
| SRP040447_lung | 0 .00 RPM | 25 .90 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 8 .04 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015101 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000000601 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000003552 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000003985 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000019440 | 4 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000012238 | 8 retrocopies | |
| Echinops telfairi | ENSETEG00000010379 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000016379 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004218 | 2 retrocopies | |
| Homo sapiens | ENSG00000164104 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015882 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002256 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000003527 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006662 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000015204 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000016597 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000013167 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000015650 | 1 retrocopy |