RetrogeneDB ID: | retro_cpor_867 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_30:16058768..16059113(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TIMM17B | ||
| Ensembl ID: | ENSCPOG00000008768 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.76 % |
| Parental protein coverage: | 65.7 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIQHRLRGSVNAVRIRAPQIGGSFAVWG |
| MEEY..EP..W..VD.C.GA...G..GGGVFQAIKGF..APVGIQH.LRG.VNAVRIRAP..GG.F...G | |
| Retrocopy | MEEYT*EPWLWKAVDGCSGALVVGMMGGGVFQAIKGFHKAPVGIQHKLRGRVNAVRIRAPHLGGIFSM-G |
| Parental | GLFSTIDCGLVRMRGKEDPWNSIT-SG--ALTGAVLAARSGPLAMV |
| .LFS.I.CGL..M..KE.PW..IT.SG..A..G..L.A........ | |
| Retrocopy | RLFSIINCGLLQMWDKEHPWSPITCSGPLAMVGGILLALAESISIL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 7 .07 RPM |
| SRP017611_kidney | 0 .00 RPM | 21 .57 RPM |
| SRP017611_liver | 0 .00 RPM | 18 .19 RPM |
| SRP040447_lung | 0 .00 RPM | 21 .26 RPM |
| SRP040447_skeletal_muscle | 0 .01 RPM | 23 .04 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012474 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000018496 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000008768 | 2 retrocopies |
retro_cpor_867 , retro_cpor_893,
|
| Dasypus novemcinctus | ENSDNOG00000025897 | 2 retrocopies | |
| Felis catus | ENSFCAG00000002569 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000011427 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000004174 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000005971 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000009148 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004547 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000013675 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031158 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000007902 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027418 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000007643 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014173 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000010396 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000009578 | 1 retrocopy |