RetrogeneDB ID: | retro_cpor_857 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_3:36716492..36716794(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPL36 | ||
| Ensembl ID: | ENSCPOG00000022839 | ||
| Aliases: | None | ||
| Description: | 60S ribosomal protein L36 [Source:UniProtKB/TrEMBL;Acc:H0WCA3] |
| Percent Identity: | 56.31 % |
| Parental protein coverage: | 96.23 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | YPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVR-DMIREVCGFAPYERRAMELLKVSKDKRALKFI |
| Y..A.GLNK.H...KN.SKPRHS.....L..H.K.V..DMI.EV.GF.P.E..AME.LKVSK.K.ALKFI | |
| Retrocopy | YLKAMGLNKNHTLMKNMSKPRHSCHCKCLIMHSKIVW<DMIFEVDGFTPHEWHAMEMLKVSKYKWALKFI |
| Parental | KKRVVGTHIRAKRKREELSNVLAAMRKAAAKKD |
| K......H...K.K.EELSN.LA.M.KA...KD | |
| Retrocopy | KQN-LRAHTHVKGKHEELSNMLATMGKATTNKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 26 .52 RPM |
| SRP017611_kidney | 0 .00 RPM | 76 .95 RPM |
| SRP017611_liver | 0 .00 RPM | 29 .77 RPM |
| SRP040447_lung | 0 .00 RPM | 134 .73 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 135 .84 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012349 | 6 retrocopies | |
| Bos taurus | ENSBTAG00000001794 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000017072 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000022839 | 3 retrocopies |
retro_cpor_1317, retro_cpor_1343, retro_cpor_857 ,
|
| Dasypus novemcinctus | ENSDNOG00000005163 | 8 retrocopies | |
| Felis catus | ENSFCAG00000011838 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015365 | 11 retrocopies | |
| Latimeria chalumnae | ENSLACG00000015161 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002743 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000001275 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000006166 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000057863 | 9 retrocopies | |
| Otolemur garnettii | ENSOGAG00000027049 | 12 retrocopies | |
| Pongo abelii | ENSPPYG00000009431 | 12 retrocopies | |
| Rattus norvegicus | ENSRNOG00000033473 | 5 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000013492 | 8 retrocopies | |
| Sus scrofa | ENSSSCG00000030010 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000020518 | 2 retrocopies |