RetrogeneDB ID: | retro_cpor_855 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_3:36321413..36321637(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCPOG00000011748 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 64.1 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 3 |
| Parental | TGKMFILSDGEGK-NGTVELMEPLD-EEISGIVEVVGRVTAKATIMCSSYVQFREDNN-PFDLGLYNEAV |
| TG....LSDGEGK.N.T.ELM.P...E.ISGI.EVVGR.TAK..IMC..Y.QFREDNN..F.L.LYN.AV | |
| Retrocopy | TG*TLVLSDGEGK>NRTSELMKPFE<EIISGIMEVVGRITAKVIIMCVFYLQFREDNN<SFYLRLYNVAV |
| Parental | KIIHEFPQ |
| .II.EFPQ | |
| Retrocopy | EIIYEFPQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 4 .43 RPM |
| SRP017611_kidney | 0 .00 RPM | 5 .97 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .62 RPM |
| SRP040447_lung | 0 .00 RPM | 9 .21 RPM |
| SRP040447_skeletal_muscle | 0 .12 RPM | 4 .10 RPM |