RetrogeneDB ID: | retro_cpor_740 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_26:10652189..10652609(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP5S | ||
| Ensembl ID: | ENSCPOG00000014471 | ||
| Aliases: | None | ||
| Description: | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B) [Source:HGNC Symbol;Acc:18799] |
| Percent Identity: | 70. % |
| Parental protein coverage: | 70. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | TVRYHGQERWQKDYNQLPTGPLDKYKIQAIDATDSCIMNIGFDHMEGLEHVEKIKLCKCHYIEDDCLLRI |
| ...Y.GQERWQK..N.LPTGPLDK.KIQAI..T..CI.NIG.DHM..L.HVEKIKL.KC.YIED.CL.RI | |
| Retrocopy | SLHYCGQERWQKGSNYLPTGPLDKSKIQAINETEFCINNIGLDHMNRLQHVEKIKLYKCNYIEDECLVRI |
| Parental | SQLEKLQKSLLEMEIISCGNVTDKGIVALRHLRNLKYLLLSDLPGVREKENIVQVFKTTLPSLELELQLK |
| .Q.E.LQKS.LE..IIS..NVTDKG..AL.HLRNLKYLLLSDL.GVR....IVQVFKT.L..LEL.L.LK | |
| Retrocopy | HQHEYLQKSILEIKIISYRNVTDKGTIALHHLRNLKYLLLSDLAGVRXXXXIVQVFKTILS*LELKLKLK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 5 .87 RPM |
| SRP017611_kidney | 0 .00 RPM | 7 .22 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .01 RPM |
| SRP040447_lung | 0 .00 RPM | 3 .25 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 5 .93 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009828 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000014285 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000014471 | 1 retrocopy |
retro_cpor_740 ,
|
| Felis catus | ENSFCAG00000029962 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000013773 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000006173 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000007707 | 1 retrocopy |