RetrogeneDB ID: | retro_cpor_652 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_21:9990147..9990513(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RAB18 | ||
| Ensembl ID: | ENSCPOG00000002234 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 79.03 % |
| Parental protein coverage: | 58.94 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | ILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHS-MLFIEASAK |
| .LVYDVTRRDTF..LDNWLNE..T.CT.ND..N.LVGN.IDKENREVDRNEGLKF..K.S.MLFIE.SAK | |
| Retrocopy | VLVYDVTRRDTFAELDNWLNEI*THCTKNDTINVLVGNQIDKENREVDRNEGLKFSQKDS<MLFIETSAK |
| Parental | -TCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHMEESHGGGACGGYCSVL |
| .....VQCAF.ELVEKIIQTPGLWESENQNKGVKLSHMEESHG.GACGG...VL | |
| Retrocopy | >SFGSVQCAFGELVEKIIQTPGLWESENQNKGVKLSHMEESHGEGACGGVLIVL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 43 .94 RPM |
| SRP017611_kidney | 0 .00 RPM | 44 .39 RPM |
| SRP017611_liver | 0 .00 RPM | 39 .00 RPM |
| SRP040447_lung | 0 .00 RPM | 47 .77 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 25 .45 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009871 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000005565 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000002234 | 2 retrocopies |
retro_cpor_633, retro_cpor_652 ,
|
| Dipodomys ordii | ENSDORG00000014338 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000008253 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000022307 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000028015 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000018972 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000007613 | 1 retrocopy |