RetrogeneDB - Retrocopy retro_cpor

	RetrogeneDB ID:	retro_cpor_597
Retrocopy location	Organism:	*Guinea Pig (Cavia porcellus)*
	Coordinates:	scaffold_2:14682183..14682351(-)
	Located in intron of:	None
Retrocopy information	Ensembl ID:	None
	Aliases:	None
	Status:	NOVEL
Parental gene information	Parental gene summary:
	Parental gene symbol:	None
	Ensembl ID:	ENSCPOG00000013590
	Aliases:	None
	Description:	None

Retrocopy-Parental alignment summary:

						
>retro_cpor_597
ATGTCTTATGAACAGCAGCAGTGCAAGCAGCGTTGCCAGCCACCTCCTGTGGTCATAACTCTGAAGTGCCCTGAGCCATG

CCCACCTCCAAAGTGCCCTGAGCTGTGTCTACCTTCACAACAGCAATGTCCTGTGCAACCTCCCCAATGCTGCCAGCAGA

AGTGCCCC

ORF - retro_cpor_597 Open Reading Frame is conserved.

Retrocopy - Parental Gene Alignment summary:

Percent Identity:	51.79 %
Parental protein coverage:	76.71 %
Number of stop codons detected:	0
Number of frameshifts detected	0

Retrocopy - Parental Gene Alignment:

									ParentalMSYQQQQCKQPCQPPPVVIQQQCPPVHPAPSCQQKYPPKNNLQSCIPTYCEQQQCP
		MSY.QQQCKQ.CQPPPVVI...CP...P.P.C.....P........P..C.QQ.CP
RetrocopyMSYEQQQCKQRCQPPPVVITLKCPEPCPPPKCPELCLPSQQQCPVQPPQCCQQKCP

							Legend:
							
								*Stop codon
>Forward frameshift by one nucleotide
<Reverse frameshift by one nucleotide

RNA-Seq - click to see more details

(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)

Expression validation based on RNA-Seq data:

Library	Retrocopy expression	Parental gene expression
SRP017611_brain	0 .00 RPM	0 .00 RPM
SRP017611_kidney	0 .00 RPM	0 .00 RPM
SRP017611_liver	0 .00 RPM	0 .00 RPM
SRP040447_lung	0 .00 RPM	0 .00 RPM
SRP040447_skeletal_muscle	0 .00 RPM	0 .00 RPM

ChIP-Seq - click to see more details

Cavia porcellus was not studied using ChIP-Seq data.

EST - click to see more details

No EST(s) were mapped for retro_cpor_597 retrocopy.

TSS - click to see more details

Cavia porcellus was not studied using FANTOM5 data.

Lab - click to see more details

retro_cpor_597 was not experimentally validated.

Retrocopy orthology:

Cavia porcellus does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.

Parental genes homology:

Parental genes homology involve 1 parental gene, and 1 retrocopy.

Species	Parental gene accession	Retrocopies number
Cavia porcellus	ENSCPOG00000013590	1 retrocopy	retro_cpor_597 ,

Parental	MSYQQQQCKQPCQPPPVVIQQQCPPVHPAPSCQQKYPPKNNLQSCIPTYCEQQQCP
	MSY.QQQCKQ.CQPPPVVI...CP...P.P.C.....P........P..C.QQ.CP
Retrocopy	MSYEQQQCKQRCQPPPVVITLKCPEPCPPPKCPELCLPSQQQCPVQPPQCCQQKCP

*	Stop codon
>	Forward frameshift by one nucleotide
<	Reverse frameshift by one nucleotide

RetrogeneDB ID:

retro_cpor_597