RetrogeneDB ID: | retro_cpor_552 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_19:3146073..3146451(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PTP4A1 | ||
| Ensembl ID: | ENSCPOG00000025759 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 62.69 % |
| Parental protein coverage: | 75.72 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 3 |
| Parental | TTIVRVCEATYDTTLVEKEGIHVFDWPFDDGAPPSNQIVDDWLNLVKIKFRE-EPGCCIAVHCVAGLGRA |
| .T.V..C...YD...V.KEGI.V.DWPFDDG.P.SNQI.DDWLN..K.KF.E.EPGCCI.VH.VA.L..A | |
| Retrocopy | STLVQICDTVYDKAPV*KEGIYVLDWPFDDGVPSSNQILDDWLNHLKTKFLE<EPGCCIVVHYVARLRQA |
| Parental | PVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPK-MRLR-FKDSNGHRNNCCMQ |
| PV.VALALI..GMKYED...FIRQKRR..F..KQLLYL.KY.PK.MRL....D.N.....CC.Q | |
| Retrocopy | PVSVALALIKCGMKYEDTDHFIRQKRR-TFICKQLLYLKKYQPK<MRLY<LRDNN---RRCCVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 27 .44 RPM |
| SRP017611_kidney | 0 .00 RPM | 23 .45 RPM |
| SRP017611_liver | 0 .00 RPM | 21 .28 RPM |
| SRP040447_lung | 0 .00 RPM | 27 .29 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 37 .03 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002275 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000025759 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000008183 | 6 retrocopies | |
| Latimeria chalumnae | ENSLACG00000007183 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000006572 | 8 retrocopies | |
| Myotis lucifugus | ENSMLUG00000001162 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002777 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000018701 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000440 | 6 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006311 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000004938 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000016743 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000011771 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000046370 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000009956 | 14 retrocopies | |
| Tursiops truncatus | ENSTTRG00000004129 | 6 retrocopies | |
| Vicugna pacos | ENSVPAG00000004277 | 9 retrocopies |