RetrogeneDB ID: | retro_cpor_372 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_136:2544746..2544948(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PPIA | ||
| Ensembl ID: | ENSCPOG00000002632 | ||
| Aliases: | None | ||
| Description: | Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:H0UZ02] |
| Percent Identity: | 52.86 % |
| Parental protein coverage: | 65.38 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | MVNPTVFFDIAADGEPLGRVSFELYA-DKVPKTAENFRAL-STGEKGFGYKGSCFHRIIPGFMCQGGDFT |
| MVN.T.F.........LG..SF.L....KVPKTAE.F....S.G.K.F.Y...CFHRIIP.FMC..GDFT | |
| Retrocopy | MVNVTTFSNTVVYVKALGFISFKLFE<GKVPKTAEKFVSQ<SIGKKKFSYNVFCFHRIIPRFMC*CGDFT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 464 .33 RPM |
| SRP017611_kidney | 0 .00 RPM | 448 .59 RPM |
| SRP017611_liver | 0 .00 RPM | 277 .27 RPM |
| SRP040447_lung | 0 .00 RPM | 585 .22 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 191 .42 RPM |