RetrogeneDB ID: | retro_cpor_1377 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_76:7067292..7067514(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS23 | ||
| Ensembl ID: | ENSCPOG00000022705 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.74 % |
| Parental protein coverage: | 51.75 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | ANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVR-VQLIKNGKK-ITAFVPNDGCLNFIEENDEVLVAGF |
| A.P.GGAS.AK.I.LE.VG.E.KQPNS.I.KCVR.VQLIKN.KK.IT.FVP..G.LNFIEEND.VL.A.. | |
| Retrocopy | ASPSGGASNAKEIMLEEVGAETKQPNSVISKCVR<VQLIKNSKK>ITVFVPKNGSLNFIEENDKVLGAVC |
| Parental | GRKGHA |
| G.K.HA | |
| Retrocopy | GQKVHA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .12 RPM | 49 .23 RPM |
| SRP017611_kidney | 0 .94 RPM | 101 .23 RPM |
| SRP017611_liver | 0 .57 RPM | 70 .91 RPM |
| SRP040447_lung | 0 .15 RPM | 175 .21 RPM |
| SRP040447_skeletal_muscle | 0 .37 RPM | 135 .13 RPM |