RetrogeneDB ID: | retro_cpor_1259 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_60:583382..583817(+) | ||
| Located in intron of: | ENSCPOG00000009348 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPL5 | ||
| Ensembl ID: | ENSCPOG00000000698 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 73.47 % |
| Parental protein coverage: | 50.34 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | YAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGKPGAFTCYLDA |
| ..H......V..GL..Y.AAYCTGLLLARRLLN.F.MDK.YEGQV.VTG.EYNVESID.K.GAFTCYLD. | |
| Retrocopy | HMHMNYQISVQAGLAKYSAAYCTGLLLARRLLNKFSMDKSYEGQVKVTGAEYNVESIDRKSGAFTCYLDT |
| Parental | GLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDA |
| GLARTT.GNK.FGA.K.A.DG.LS.PHST...P.YDSESKEF.AE.H.K.IMGQNV..YMRYLMEE.EDA | |
| Retrocopy | GLARTTNGNKIFGAQKDALDGVLSVPHSTT*VPAYDSESKEFSAEEHQKRIMGQNV-NYMRYLMEE-EDA |
| Parental | YKKQFSQ |
| YKKQFSQ | |
| Retrocopy | YKKQFSQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .17 RPM | 227 .19 RPM |
| SRP017611_kidney | 0 .00 RPM | 364 .84 RPM |
| SRP017611_liver | 0 .13 RPM | 197 .35 RPM |
| SRP040447_lung | 0 .05 RPM | 287 .27 RPM |
| SRP040447_skeletal_muscle | 0 .08 RPM | 318 .57 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009878 | 5 retrocopies | |
| Bos taurus | ENSBTAG00000002026 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000000698 | 8 retrocopies |
retro_cpor_1047, retro_cpor_1097, retro_cpor_1141, retro_cpor_1259 , retro_cpor_1354, retro_cpor_1387, retro_cpor_428, retro_cpor_737,
|
| Equus caballus | ENSECAG00000021065 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006361 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000011635 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000004150 | 6 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000004669 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000010089 | 2 retrocopies | |
| Petromyzon marinus | ENSPMAG00000002040 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000015117 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000023529 | 6 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000006417 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000006899 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000010560 | 5 retrocopies | |
| Tursiops truncatus | ENSTTRG00000013097 | 5 retrocopies |