RetrogeneDB ID: | retro_cpor_1164 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_51:11276571..11276878(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | THOC7 | ||
| Ensembl ID: | ENSCPOG00000007930 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.14 % |
| Parental protein coverage: | 50.49 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 2 |
| Parental | YSQYQRMLSTLSQCEFSMGKTLLVY-DMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKN |
| YSQYQRML.TLSQCEFS.GKTLLV.......E....E..YKE.E..IA.A.EK.AE.KKQIL.A....KN | |
| Retrocopy | YSQYQRMLRTLSQCEFSRGKTLLVL<MIRISETGKTERDYKETERCIAAA*EKVAEYKKQILPANE*EKN |
| Parental | RQEYDA-LAKVIQHHPDRHETLKELEALGKELEHL |
| .QE..A....V.QH.PD..ET.K..EA...E.EHL | |
| Retrocopy | HQEQNA<FSMVTQHQPDKKETVKGREAR*RESEHL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .06 RPM | 11 .96 RPM |
| SRP017611_kidney | 0 .00 RPM | 24 .08 RPM |
| SRP017611_liver | 0 .00 RPM | 27 .20 RPM |
| SRP040447_lung | 0 .00 RPM | 18 .84 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 22 .37 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012170 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000034899 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000007930 | 2 retrocopies |
retro_cpor_1127, retro_cpor_1164 ,
|
| Dasypus novemcinctus | ENSDNOG00000005917 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000001987 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012060 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000021860 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000024865 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000013894 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011491 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000007069 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000013618 | 3 retrocopies | |
| Vicugna pacos | ENSVPAG00000010083 | 1 retrocopy |