RetrogeneDB ID: | retro_cjac_888 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 11:9407557..9407805(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000012417 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 73.81 % |
| Parental protein coverage: | 90.22 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | VGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAV |
| V....KY.T.YGAS..KMVK..EISQH.KY.CSFCGKTKMKR.AV.I.HCG..MKT.AGG.WTYNTT.AV | |
| Retrocopy | VRMISKYWTLYGASIQKMVKETEISQHTKYSCSFCGKTKMKRQAVKIRHCGYFMKTAAGGTWTYNTTCAV |
| Parental | T-VKSAIRRLKELK |
| T..KSAIRRLKELK | |
| Retrocopy | T<IKSAIRRLKELK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .07 RPM | 55 .78 RPM |
| SRP051959_heart | 0 .16 RPM | 72 .97 RPM |
| SRP051959_kidney | 0 .04 RPM | 66 .85 RPM |
| SRP051959_liver | 0 .00 RPM | 77 .00 RPM |
| SRP051959_lung | 0 .08 RPM | 66 .71 RPM |
| SRP051959_lymph_node | 0 .07 RPM | 110 .57 RPM |
| SRP051959_skeletal_muscle | 0 .04 RPM | 118 .82 RPM |
| SRP051959_spleen | 0 .11 RPM | 91 .49 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_642 |