RetrogeneDB ID: | retro_cjac_868 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 11:90761605..90761848(+) | ||
| Located in intron of: | ENSCJAG00000006191 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CRB3 | ||
| Ensembl ID: | ENSCJAG00000016567 | ||
| Aliases: | None | ||
| Description: | crumbs homolog 3 (Drosophila) [Source:HGNC Symbol;Acc:20237] |
| Percent Identity: | 75.86 % |
| Parental protein coverage: | 70.16 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MANPGLGLLLALGLPFLLARWGRAWGQVPTSSANESSTVLPTSTSPSSSSSSNGTLSQGAITAIIVVFSI |
| MANPGLGLLL.LGLP.LLARWG.AW.Q..T.SANESST.L...TSP..SSSS.G.LSQGAITAIIVVFS. | |
| Retrocopy | MANPGLGLLLVLGLPLLLARWG*AWSQTSTPSANESSTILLIHTSP--SSSSHGALSQGAITAIIVVFSL |
| Parental | LAALLLAVGLALLVRKL |
| L....LAVGLALLV.KL | |
| Retrocopy | L----LAVGLALLVWKL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .02 RPM | 5 .52 RPM |
| SRP051959_heart | 0 .04 RPM | 0 .07 RPM |
| SRP051959_kidney | 0 .04 RPM | 5 .28 RPM |
| SRP051959_liver | 0 .09 RPM | 1 .39 RPM |
| SRP051959_lung | 0 .07 RPM | 2 .41 RPM |
| SRP051959_lymph_node | 0 .02 RPM | 1 .14 RPM |
| SRP051959_skeletal_muscle | 0 .59 RPM | 0 .02 RPM |
| SRP051959_spleen | 0 .00 RPM | 0 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000016567 | 1 retrocopy |
retro_cjac_868 ,
|
| Homo sapiens | ENSG00000130545 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007070 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000005599 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015936 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009457 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010367 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000047322 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002396 | 1 retrocopy |