RetrogeneDB ID: | retro_cjac_548 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 1:74595391..74595677(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MRPL51 | ||
| Ensembl ID: | ENSCJAG00000018232 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein L51 [Source:HGNC Symbol;Acc:14044] |
| Percent Identity: | 60.2 % |
| Parental protein coverage: | 75. % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 2 |
| Parental | MAGSLLCGVGRRLLDWVPLACRSFSLDVPRLMGIRLTLPPPK-VVDRWNEKRAMFGVYDNIGILGNFEKH |
| .AGSL.C..GR.L..WV.LA.RSFSL.VP.L...RL...P.K..VD.WN.KRAMFGVYDN.GILGN...H | |
| Retrocopy | IAGSL*CRAGRHLRGWVLLAYRSFSLGVPGLTRVRLPPNPSK<AVDGWNNKRAMFGVYDNTGILGN*NAH |
| Parental | -PKELIRGPVWLRGWKGNELQRCIRKKK |
| .P..L.R.P..L..WKGNEL..C..KKK | |
| Retrocopy | <PNNLSRDPR*LQAWKGNEL*HCSQKKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .13 RPM | 12 .91 RPM |
| SRP051959_heart | 0 .00 RPM | 23 .80 RPM |
| SRP051959_kidney | 0 .00 RPM | 31 .90 RPM |
| SRP051959_liver | 0 .00 RPM | 33 .86 RPM |
| SRP051959_lung | 0 .02 RPM | 16 .19 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 12 .53 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 42 .10 RPM |
| SRP051959_spleen | 0 .00 RPM | 14 .64 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000014729 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018232 | 1 retrocopy |
retro_cjac_548 ,
|
| Cavia porcellus | ENSCPOG00000008478 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000002106 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000030335 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000012566 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019165 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000000936 | 2 retrocopies |