RetrogeneDB ID: | retro_cjac_3874 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | GL285606.1:1628..1893(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RARRES2 | ||
| Ensembl ID: | ENSCJAG00000010322 | ||
| Aliases: | None | ||
| Description: | retinoic acid receptor responder (tazarotene induced) 2 [Source:HGNC Symbol;Acc:9868] |
| Percent Identity: | 56.04 % |
| Parental protein coverage: | 54.66 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | QQTDCRKEDWKKPHCKVKPNGRKRKCLACIKLGSENEVLGRMIHCPT-KTQVLREPKEYQENQCIKVQRA |
| ..T..R...WKKP.CKV.PNGRK.KCL.C.KLGSE..VL.RM.HCPT.KTQ..REP...QE..C.....A | |
| Retrocopy | RHTSGRRKGWKKPKCKVQPNGRKQKCLTCVKLGSEDKVLDRMVHCPT<KTQTWREPE*RQETWCSAAELA |
| Parental | -GEDPNSLGFPG-LLFSKALP |
| ..E.P.S...P...LFSK.LP | |
| Retrocopy | <DEEPCSHCLPAQFLFSKVLP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 2 .26 RPM |
| SRP051959_heart | 0 .00 RPM | 3 .46 RPM |
| SRP051959_kidney | 0 .00 RPM | 2 .06 RPM |
| SRP051959_liver | 0 .00 RPM | 17 .55 RPM |
| SRP051959_lung | 0 .00 RPM | 3 .89 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 2 .44 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 0 .81 RPM |
| SRP051959_spleen | 0 .00 RPM | 2 .58 RPM |