RetrogeneDB ID: | retro_cjac_2615 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 5:60960595..60961000(-) | ||
| Located in intron of: | ENSCJAG00000012375 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PNO1 | ||
| Ensembl ID: | ENSCJAG00000006564 | ||
| Aliases: | None | ||
| Description: | RNA-binding protein PNO1 [Source:RefSeq peptide;Acc:NP_001257650] |
| Percent Identity: | 84.78 % |
| Parental protein coverage: | 53.97 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | NVEIRTCKETRDVSALT-KAADFVKAFILGFQVEDALALIRLDDLFLESFEITDVKPLKGDHLSRA-IGR |
| N...RTC.ETRDVSA...KAADFVKAFILGFQVEDALAL.R.D.LFLESF.ITD.KPLKGDHLSRA..GR | |
| Retrocopy | NLKSRTCTETRDVSAPA<KAADFVKAFILGFQVEDALALLRVDGLFLESFQITDLKPLKGDHLSRA>TGR |
| Parental | IAGKGGKTKFTIENVTRTRIVLADVKVHILGSFQNIKMARTAICNLILGNPPSKVYGNIRAVASRSAD |
| IAG.GGKTKFTIENVTR..IVLAD.KVHILGSFQNIKMARTAICNLILGN.P.KVYGNIRAVA.RSAD | |
| Retrocopy | IAGEGGKTKFTIENVTRPWIVLADGKVHILGSFQNIKMARTAICNLILGN-PAKVYGNIRAVAIRSAD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .93 RPM | 8 .30 RPM |
| SRP051959_heart | 0 .39 RPM | 6 .54 RPM |
| SRP051959_kidney | 0 .49 RPM | 11 .60 RPM |
| SRP051959_liver | 0 .52 RPM | 8 .86 RPM |
| SRP051959_lung | 0 .49 RPM | 5 .81 RPM |
| SRP051959_lymph_node | 1 .10 RPM | 6 .96 RPM |
| SRP051959_skeletal_muscle | 0 .63 RPM | 8 .87 RPM |
| SRP051959_spleen | 0 .74 RPM | 7 .52 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000003256 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000006564 | 3 retrocopies |
retro_cjac_2615 , retro_cjac_273, retro_cjac_4127,
|
| Felis catus | ENSFCAG00000025330 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000000046 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000010897 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010850 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000017461 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009993 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000006100 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016637 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000012353 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005524 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000008352 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000004007 | 1 retrocopy |