RetrogeneDB ID: | retro_cjac_2539 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 5:81064614..81064945(+) | ||
| Located in intron of: | ENSCJAG00000019846 | ||
Retrocopyinformation | Ensembl ID: | ENSCJAG00000019851 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPLP2 | ||
| Ensembl ID: | ENSCJAG00000011838 | ||
| Aliases: | None | ||
| Description: | ribosomal protein, large, P2 [Source:HGNC Symbol;Acc:10377] |
| Percent Identity: | 80. % |
| Parental protein coverage: | 99.13 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MRYVASYLLAALGGNPSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGA |
| M.YV.S.LLAALGGNPSPSAKD.K.ILDSVGI.ADDD.LNKVISELNGK.IEDVIAQGIGKLASVPAGGA | |
| Retrocopy | MCYVVSHLLAALGGNPSPSAKD-KRILDSVGIKADDDQLNKVISELNGKSIEDVIAQGIGKLASVPAGGA |
| Parental | VAISAAPGSAAPAAGSAPAAAEEKKDEK-KEESEESDDDMGFGLF |
| VA.SAAPGSAAPAAGS.P.AAEEK.......ESE...DD.GF.LF | |
| Retrocopy | VAVSAAPGSAAPAAGSTPDAAEEKMRRS>SKESE---DDTGFDLF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 56 .29 RPM |
| SRP051959_heart | 0 .00 RPM | 48 .41 RPM |
| SRP051959_kidney | 0 .00 RPM | 50 .56 RPM |
| SRP051959_liver | 0 .00 RPM | 57 .68 RPM |
| SRP051959_lung | 0 .02 RPM | 68 .44 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 125 .31 RPM |
| SRP051959_skeletal_muscle | 0 .04 RPM | 72 .76 RPM |
| SRP051959_spleen | 0 .00 RPM | 70 .78 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1777 |
| Pan troglodytes | retro_ptro_1189 |
| Gorilla gorilla | retro_ggor_2238 |
| Pongo abelii | retro_pabe_1537 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006935 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000001777 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000009523 | 1 retrocopy | |
| Ciona intestinalis | ENSCING00000000626 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000011838 | 6 retrocopies |
retro_cjac_2399, retro_cjac_2497, retro_cjac_2539 , retro_cjac_2745, retro_cjac_3097, retro_cjac_3859,
|
| Echinops telfairi | ENSETEG00000010240 | 4 retrocopies | |
| Felis catus | ENSFCAG00000008417 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020627 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000009049 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000026860 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016296 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000002116 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000001056 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000012842 | 1 retrocopy |