RetrogeneDB ID: | retro_cjac_2085 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 22:8878387..8878780(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | UBXN2A | ||
| Ensembl ID: | ENSCJAG00000007665 | ||
| Aliases: | None | ||
| Description: | UBX domain protein 2A [Source:HGNC Symbol;Acc:27265] |
| Percent Identity: | 72.99 % |
| Parental protein coverage: | 64.25 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 4 |
| Parental | QPLGNNQQSNCEYFVDSLFEEAQKVGSKCVSSTEQKKQVDVNIK-LWKNGFTV-NDDFRSYSDGASQQFL |
| QPLG.NQQ..CEY.V.SLF.EAQKVGSKC.S.TEQKKQVD.NIK.LW.NGFTV..DDFRSYS.GAS.QFL | |
| Retrocopy | QPLGDNQQTKCEYLVNSLFYEAQKVGSKCLSHTEQKKQVDINIK>LWENGFTV<HDDFRSYSNGAS*QFL |
| Parental | NSIKKGELP-SELQRIFDKEEVD-VKVEDKKNEVCMSTKPVFQPFSGQGHRLGRVSHIKDFIEKYQG |
| NSIKKGELP..ELQ.IFDKEEVD..K....K....M..KPV.Q.FSGQ.H..GRVSHIKDF.EK.QG | |
| Retrocopy | NSIKKGELP<LELQGIFDKEEVD>LKFKTRKIKYAM--KPVLQLFSGQAHQSGRVSHIKDFTEKHQG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .49 RPM | 6 .66 RPM |
| SRP051959_heart | 0 .32 RPM | 8 .66 RPM |
| SRP051959_kidney | 0 .18 RPM | 6 .32 RPM |
| SRP051959_liver | 0 .06 RPM | 2 .23 RPM |
| SRP051959_lung | 0 .62 RPM | 10 .36 RPM |
| SRP051959_lymph_node | 0 .30 RPM | 9 .95 RPM |
| SRP051959_skeletal_muscle | 0 .04 RPM | 15 .77 RPM |
| SRP051959_spleen | 0 .53 RPM | 6 .85 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000001640 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007665 | 1 retrocopy |
retro_cjac_2085 ,
|
| Equus caballus | ENSECAG00000020144 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000002623 | 1 retrocopy | |
| Homo sapiens | ENSG00000173960 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002445 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000015640 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006487 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000020634 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000751 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000008783 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000025 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000011502 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000011705 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004950 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000010108 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000026283 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012158 | 1 retrocopy |