RetrogeneDB ID: | retro_cfam_669 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 15:58855022..58855271(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | cfa-mir-147 | ||
| Ensembl ID: | ENSCAFG00000031501 | ||
| Aliases: | None | ||
| Description: | cfa-mir-147 [Source:miRBase;Acc:MI0010371] |
| Percent Identity: | 86.75 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | MNFFQLLMKKKELIPLVLFMATAAGGASSFAVYSLQKSDVILDRKRNPEPWETVDPSVPSKLITINQEWK |
| MNFFQ.LMKKK..IPL.LFMATA..GA.SFAVYSLQKSDVILD.KRNPEP.ETVDPSVPSKLITINQEWK | |
| Retrocopy | MNFFQFLMKKKKRIPLLLFMATAESGALSFAVYSLQKSDVILDGKRNPEP*ETVDPSVPSKLITINQEWK |
| Parental | PIEELQKVRRATK |
| PIEELQK..RATK | |
| Retrocopy | PIEELQKI*RATK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 0 .17 RPM |
| SRP017611_brain | 0 .00 RPM | 0 .16 RPM |
| SRP017611_kidney | 0 .00 RPM | 10 .63 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000031501 | 2 retrocopies |
retro_cfam_1654, retro_cfam_669 ,
|
| Cavia porcellus | ENSCPOG00000020706 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000003556 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000013137 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000028279 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000029216 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000050251 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000006433 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000021929 | 1 retrocopy |