RetrogeneDB ID: | retro_cfam_2112 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | X:93277682..93277931(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MRPL20 | ||
| Ensembl ID: | ENSCAFG00000019259 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.47 % |
| Parental protein coverage: | 55.7 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | HFRGRKNRCYKLAVRAVTRAFVKCTKARRLKKRNMRTLWINRITAASQEHGLKYPAFIVNLIKCQVELNR |
| H..GR...CY.L.V..VT.AFVKC.KA.RLK.RN..TLWINR.T..S.E..L.YPAFIVN.IKC..ELNR | |
| Retrocopy | HSQGRNSQCYRLVVSSVTSAFVKC*KAQRLKMRNPETLWINRMTVPS*EYSLNYPAFIVNFIKCHMELNR |
| Parental | KVLADLAIYEPKT |
| KV.ADLAIYEP.T | |
| Retrocopy | KVFADLAIYEPET |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 28 .85 RPM |
| SRP017611_brain | 0 .00 RPM | 25 .17 RPM |
| SRP017611_kidney | 0 .00 RPM | 62 .34 RPM |
| SRP017611_liver | 0 .00 RPM | 13 .34 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000013932 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000019259 | 2 retrocopies |
retro_cfam_2112 , retro_cfam_826,
|
| Dasypus novemcinctus | ENSDNOG00000010105 | 1 retrocopy | |
| Homo sapiens | ENSG00000242485 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027251 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000011857 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000006562 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000029066 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000005968 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000001425 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000008735 | 2 retrocopies |