RetrogeneDB ID: | retro_cfam_1489 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 32:3136493..3136697(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | WDR83OS | ||
| Ensembl ID: | ENSCAFG00000028908 | ||
| Aliases: | None | ||
| Description: | WD repeat domain 83 opposite strand [Source:HGNC Symbol;Acc:30203] |
| Percent Identity: | 65.71 % |
| Parental protein coverage: | 66.04 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | NMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAVYCSFISFANSRSS |
| NMSD....NKVL.YKP.P......LDDPT.DYMNLLG.IF.M..L.LKLKWC.W.AVYCSFIS.A...SS | |
| Retrocopy | NMSDAWKANKVLKYKPLPVSFS--LDDPTLDYMNLLGIIFRMYSLLLKLKWCPWRAVYCSFISLAKHMSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 56 .91 RPM |
| SRP017611_brain | 0 .00 RPM | 30 .80 RPM |
| SRP017611_kidney | 0 .00 RPM | 55 .54 RPM |
| SRP017611_liver | 0 .00 RPM | 21 .97 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000028908 | 2 retrocopies |
retro_cfam_1489 , retro_cfam_1951,
|
| Callithrix jacchus | ENSCJAG00000005285 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019481 | 1 retrocopy | |
| Felis catus | ENSFCAG00000000463 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014450 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000059355 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000013403 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013721 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001250 | 1 retrocopy |