RetrogeneDB ID: | retro_cfam_1488 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 32:3069560..3069955(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCAFG00000023995 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNF8 | ||
| Ensembl ID: | ENSCAFG00000016893 | ||
| Aliases: | None | ||
| Description: | SNF8, ESCRT-II complex subunit [Source:HGNC Symbol;Acc:17028] |
| Percent Identity: | 63.97 % |
| Parental protein coverage: | 51.55 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 3 |
| Parental | MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQD |
| MH..GVG.G..A.KKLAEAKYKE.GTVLAEDQLA.MSKQLDM.KT.LEEF.SKHKQ.IRK..EF.VQFQ. | |
| Retrocopy | MHCCGVGTGVTA-KKLAEAKYKEQGTVLAEDQLAHMSKQLDMLKTSLEEFTSKHKQAIRKKLEFWVQFQG |
| Parental | MCATIGVDPLA-SGKGFWSEML-GVGDFYYELGVQIIEVCLALKHR-NGGLITLEELHQQVLKGRG |
| ......V.PLA.....FW...L.G......EL.V.IIEVC.ALKHR..GG.I.L.EL.Q.V.KGRG | |
| Retrocopy | ISCVTCVPPLA>GSSAFWKRIL<GLR**VWELRVPIIEVCEALKHR<DGGPIPLGELQQHVFKGRG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .04 RPM | 26 .04 RPM |
| SRP017611_brain | 0 .00 RPM | 16 .99 RPM |
| SRP017611_kidney | 0 .00 RPM | 35 .20 RPM |
| SRP017611_liver | 0 .00 RPM | 14 .94 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005062 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000016893 | 1 retrocopy |
retro_cfam_1488 ,
|
| Choloepus hoffmanni | ENSCHOG00000013760 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007322 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000000758 | 1 retrocopy | |
| Felis catus | ENSFCAG00000008944 | 2 retrocopies | |
| Homo sapiens | ENSG00000159210 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025290 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016638 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015356 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000006058 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002743 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000009156 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000008911 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000004576 | 1 retrocopy |