RetrogeneDB ID: | retro_cfam_1174 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 25:6073287..6073509(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCAFG00000006265 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SHFM1 | ||
| Ensembl ID: | ENSCAFG00000002179 | ||
| Aliases: | None | ||
| Description: | split hand/foot malformation (ectrodactyly) type 1 [Source:HGNC Symbol;Acc:10845] |
| Percent Identity: | 93.24 % |
| Parental protein coverage: | 75.51 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | RSVAMSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYK |
| .SV.MSEKKQPVDLGLLEEDDEFEEFP.EDWAGLDEDEDAHVWEDNWDDDN.EDDFSNQLRAELEKHGY. | |
| Retrocopy | QSVTMSEKKQPVDLGLLEEDDEFEEFPGEDWAGLDEDEDAHVWEDNWDDDNEEDDFSNQLRAELEKHGYM |
| Parental | METS |
| METS | |
| Retrocopy | METS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .34 RPM | 33 .64 RPM |
| SRP017611_brain | 0 .16 RPM | 12 .23 RPM |
| SRP017611_kidney | 1 .12 RPM | 68 .48 RPM |
| SRP017611_liver | 0 .00 RPM | 12 .40 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000002179 | 1 retrocopy |
retro_cfam_1174 ,
|
| Cavia porcellus | ENSCPOG00000010402 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019778 | 1 retrocopy | |
| Felis catus | ENSFCAG00000023254 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000014208 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000026246 | 3 retrocopies |