RetrogeneDB ID: | retro_btau_808 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 2:709892..710241(+) | ||
| Located in intron of: | ENSBTAG00000013916 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NDUFA5 | ||
| Ensembl ID: | ENSBTAG00000009334 | ||
| Aliases: | NDUFA5, B13 | ||
| Description: | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 [Source:UniProtKB/Swiss-Prot;Acc:P23935] |
| Percent Identity: | 61.34 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected | 3 |
| Parental | MAGLLKKTTGLVGLA-VCETPHERLKILYTKIL-DVLGHIPKNAAYRKYTEQITNEKLSMVKAEPDVKKL |
| M.G...KTTGLVGLA.....PHE.L...YTKIL.DVLG.IPKN..YR.Y...ITN.KL..VK.EP.V.KL | |
| Retrocopy | MVGWPQKTTGLVGLA>MFKSPHEKLRTWYTKIL>DVLGRIPKNTPYRRYIV*ITNKKLGIVKMEPEVIKL |
| Parental | EERLQGGQIEEVILQAENELSL-ARKMIQWKPWEPLVEEPPASQWKWPI |
| .E.LQ.G........AENELSL.ARKM..WK.WE..VEEPPA.QWKW.I | |
| Retrocopy | KEQLQSG**KR*FF*AENELSL<ARKMVEWKTWESSVEEPPANQWKWII |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 10 .09 RPM |
| ERP005899_muscle | 0 .00 RPM | 18 .37 RPM |
| SRP017611_brain | 0 .00 RPM | 24 .58 RPM |
| SRP017611_kidney | 0 .00 RPM | 31 .06 RPM |
| SRP017611_liver | 0 .00 RPM | 12 .38 RPM |
| SRP030211_testis | 0 .00 RPM | 30 .25 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004512 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000009334 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000025112 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000017449 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027125 | 5 retrocopies | |
| Homo sapiens | ENSG00000128609 | 10 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022922 | 9 retrocopies | |
| Loxodonta africana | ENSLAFG00000030971 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000015384 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000006811 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000023089 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000033137 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000017956 | 10 retrocopies | |
| Pan troglodytes | ENSPTRG00000019637 | 10 retrocopies | |
| Rattus norvegicus | ENSRNOG00000005698 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000016607 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000027404 | 1 retrocopy |