RetrogeneDB ID: | retro_amel_409 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL192429.1:946139..946355(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | AP2S1 | ||
| Ensembl ID: | ENSAMEG00000008394 | ||
| Aliases: | None | ||
| Description: | adaptor-related protein complex 2, sigma 1 subunit [Source:HGNC Symbol;Acc:565] |
| Percent Identity: | 65.82 % |
| Parental protein coverage: | 54.11 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | CICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIREXIRETSQTKVLK |
| CI..DVNDNNL.YL..I..FVE.LNE.FHNV.E..LVFNFYKVYTVV.EM..AGEI.E....TSQ..V.. | |
| Retrocopy | CINMDVNDNNLPYLK-ISSFVEILNECFHNVWE--LVFNFYKVYTVVNEMSPAGEI*E----TSQILVVT |
| Parental | QLLMLQSLE |
| QLL.L.SL. | |
| Retrocopy | QLLRLPSLQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002673 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000008394 | 1 retrocopy |
retro_amel_409 ,
|
| Macropus eugenii | ENSMEUG00000001062 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000008036 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000015865 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000012548 | 1 retrocopy |