RetrogeneDB ID: | retro_amel_1472 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL193456.1:121953..122145(-) | ||
| Located in intron of: | ENSAMEG00000001821 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LYRM7 | ||
| Ensembl ID: | ENSAMEG00000017776 | ||
| Aliases: | None | ||
| Description: | LYR motif containing 7 [Source:HGNC Symbol;Acc:28072] |
| Percent Identity: | 68.75 % |
| Parental protein coverage: | 65.31 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | KSNKSETSPKKIEELIKIGSDVELLLRTSVIQGIHTDHNTLKLVPRKELLIENVPYCDAPTQKQ |
| K.....T.......LI.I.S.VELLLRTSVIQGI.TDH.TLKLVPRKELL..NV.YCDAPTQKQ | |
| Retrocopy | KPTQKPTEILSLPKLIEIDSNVELLLRTSVIQGIQTDHDTLKLVPRKELLTQNVLYCDAPTQKQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017776 | 1 retrocopy |
retro_amel_1472 ,
|
| Canis familiaris | ENSCAFG00000000736 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000006766 | 6 retrocopies | |
| Echinops telfairi | ENSETEG00000010130 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000166 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000015568 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000045961 | 1 retrocopy |