RetrogeneDB ID: | retro_amel_1014 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL192829.1:1037548..1037725(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSAMEG00000001058 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 62.71 % |
| Parental protein coverage: | 57.84 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | SNTTVPNAPQANSDSMVGYVLGPFFLITLVGVVVAVVMYVQKKKRADRLRHHLLPMYSY |
| S.TTVP.APQA.SD....YVLGPF.LI..V..VVAVVM.VQ..K..DR...HLLP..SY | |
| Retrocopy | SSTTVPSAPQAHSDPTADYVLGPFLLIA*VRGVVAVVMHVQNQKQVDRRHRHLLPVDSY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001058 | 1 retrocopy |
retro_amel_1014 ,
|
| Bos taurus | ENSBTAG00000034519 | 1 retrocopy | |
| Equus caballus | ENSECAG00000005108 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011876 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000062753 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000013398 | 1 retrocopy | |
| Pelodiscus sinensis | ENSPSIG00000004692 | 1 retrocopy |