RetrogeneDB ID: | retro_tsyr_373 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_10527:33486..33889(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HRSP12 | ||
| Ensembl ID: | ENSTSYG00000003085 | ||
| Aliases: | None | ||
| Description: | heat-responsive protein 12 [Source:HGNC Symbol;Acc:16897] |
| Percent Identity: | 88.24 % |
| Parental protein coverage: | 99.26 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MSSLIRKVISTAKAP-GAIGPYSQAVLVDRTLYISGQIGMNPSSGQLVPGGVTEEANQALKNMGEILKAA |
| MSSLIRKVISTAKAP.G...P.....LVDRTLYISGQIGM.PSSGQ.VPGGVTEEANQALKNMGEILKAA | |
| Retrocopy | MSSLIRKVISTAKAP>GPLVPIDK-LLVDRTLYISGQIGMDPSSGQIVPGGVTEEANQALKNMGEILKAA |
| Parental | GCDFTNVVKTTVLLADINDFNTVNEIY-QYFKSSFPARAAYQVAALPKGGRVEIEAVAVQGPLTTA |
| .CDFTNVVKTTVLLADINDFNTV.EIY.QYFKSSFPARAAYQVAALPKGG.VEIEAVAV.GPLTTA | |
| Retrocopy | VCDFTNVVKTTVLLADINDFNTVSEIYKQYFKSSFPARAAYQVAALPKGGQVEIEAVAVPGPLTTA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000575 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000012595 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000030250 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001278 | 8 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015560 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000025138 | 3 retrocopies | |
| Felis catus | ENSFCAG00000002167 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001185 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000002078 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011825 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000006575 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015253 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000021532 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001465 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000006079 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011452 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000003085 | 6 retrocopies | |
| Tursiops truncatus | ENSTTRG00000016066 | 5 retrocopies | |
| Vicugna pacos | ENSVPAG00000008277 | 3 retrocopies |