RetrogeneDB ID: | retro_tsyr_1288 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_381160:798..1110(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TAF12 | ||
| Ensembl ID: | ENSTSYG00000005320 | ||
| Aliases: | None | ||
| Description: | TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa [Source:HGNC Symbol;Acc:11545] |
| Percent Identity: | 74.55 % |
| Parental protein coverage: | 66.05 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | FSSLKPEPTCTLPFQGSTAASSTVVKGSATPGAETCLSQKT-NNQVLTKKKLQDLVREVDPNEQ-LDEDV |
| FSSLKPEPTCTLPFQGSTAASSTVVKGSATPGAETCLSQKT.N.....KK..Q..VR.VDPNEQ..DEDV | |
| Retrocopy | FSSLKPEPTCTLPFQGSTAASSTVVKGSATPGAETCLSQKT<NRILTKKK-FQVSVRDVDPNEQ<VDEDV |
| Parental | -EEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLH |
| ..EMLLQ.......SVVTAACQLA.HRK.ST.EV.D.Q.H | |
| Retrocopy | <GEMLLQLL-TILSSVVTAACQLAWHRKYSTQEVQDSQPH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004366 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000009742 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000009044 | 3 retrocopies | |
| Dipodomys ordii | ENSDORG00000015036 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000012597 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000000914 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012595 | 8 retrocopies | |
| Monodelphis domestica | ENSMODG00000010943 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015506 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000003935 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000001524 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000048288 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000007568 | 5 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005320 | 1 retrocopy |
retro_tsyr_1288 ,
|
| Tursiops truncatus | ENSTTRG00000005548 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000006779 | 1 retrocopy |