RetrogeneDB ID: | retro_tbel_612 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_2544:425705..425942(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CDK2AP2 | ||
| Ensembl ID: | ENSTBEG00000005476 | ||
| Aliases: | None | ||
| Description: | cyclin-dependent kinase 2 associated protein 2 [Source:HGNC Symbol;Acc:30833] |
| Percent Identity: | 53.75 % |
| Parental protein coverage: | 63.93 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | AAPFRPLFNDFGPPSMGYVQAMKPPAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKR-IIHCRA |
| ......L..D.G.PS..Y.Q......Q..QS.Y..LL..IEE.GKEIRPT..GSKSAMERLK..IIH.R. | |
| Retrocopy | SSQYHLLLSDCGLPSLQYTQGIRS-SQVPQSKYEELLAIIEELGKEIRPTNTGSKSAMERLKQSIIHARG |
| Parental | LF-ECLAKTE |
| L..ECLA..E | |
| Retrocopy | LIRECLAEME |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000011370 | 1 retrocopy | |
| Equus caballus | ENSECAG00000020079 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000006428 | 3 retrocopies | |
| Homo sapiens | ENSG00000167797 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010159 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000011827 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006438 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008275 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000003966 | 9 retrocopies | |
| Tupaia belangeri | ENSTBEG00000005476 | 2 retrocopies |
retro_tbel_439, retro_tbel_612 ,
|