RetrogeneDB ID: | retro_ptro_2508 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 7:9018889..9019182(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CDK2AP2 | ||
| Ensembl ID: | ENSPTRG00000003966 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 89.9 % |
| Parental protein coverage: | 77.78 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | SVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPP-GAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKS |
| SV.SPSGSV.GA.APFRPLFNDFGPPSMGYVQAMKPP.GAQGSQSTY.DLLSVIEE.GKEI.P.YAGSKS | |
| Retrocopy | SVSSPSGSVSGAVAPFRPLFNDFGPPSMGYVQAMKPP<GAQGSQSTYNDLLSVIEEKGKEIQPAYAGSKS |
| Parental | AMERLKRGIIHARALVRECLAETERNART |
| .MERLKRGIIHARALVRECLAETE.NART | |
| Retrocopy | TMERLKRGIIHARALVRECLAETEWNART |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 22 .84 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 9 .57 RPM |
| SRP007412_heart | 0 .00 RPM | 5 .65 RPM |
| SRP007412_kidney | 0 .00 RPM | 31 .23 RPM |
| SRP007412_liver | 0 .00 RPM | 45 .01 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .26 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3699 |
| Gorilla gorilla | retro_ggor_2502 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000011370 | 1 retrocopy | |
| Equus caballus | ENSECAG00000020079 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000006428 | 3 retrocopies | |
| Homo sapiens | ENSG00000167797 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010159 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000011827 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006438 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008275 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000003966 | 9 retrocopies |
retro_ptro_2508 , retro_ptro_2973, retro_ptro_2976, retro_ptro_3002, retro_ptro_3003, retro_ptro_3004, retro_ptro_3005, retro_ptro_3008, retro_ptro_3009,
|
| Pan troglodytes | ENSPTRG00000005596 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000005476 | 2 retrocopies |