RetrogeneDB ID: | retro_tbel_4427 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_82848:5165..5552(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CDC42 | ||
| Ensembl ID: | ENSTBEG00000002614 | ||
| Aliases: | None | ||
| Description: | cell division cycle 42 [Source:HGNC Symbol;Acc:1736] |
| Percent Identity: | 77.1 % |
| Parental protein coverage: | 82.69 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | EDYDRLRPLSY-PQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLA |
| .DYD.L..LSY.P.T.VFL.CF.VVSPSSFENVKEK.VP.ITHHC.KT.FLLVG.QIDLRDDPST.EKL. | |
| Retrocopy | KDYDIL*QLSY>PITYVFLICFTVVSPSSFENVKEK*VPDITHHCQKTLFLLVGIQIDLRDDPSTTEKLW |
| Parental | KNKQKPITP-ETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVL |
| ......ITP..TAEKLA.DLKAVKYV.C.ALTQKG..NVFDEAILAALEPPEPKKS.RCVL | |
| Retrocopy | QEQTETITP<KTAEKLASDLKAVKYVDCCALTQKGINNVFDEAILAALEPPEPKKSCRCVL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000014707 | 5 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000005306 | 10 retrocopies | |
| Callithrix jacchus | ENSCJAG00000005912 | 6 retrocopies | |
| Cavia porcellus | ENSCPOG00000006543 | 4 retrocopies | |
| Equus caballus | ENSECAG00000019180 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000004443 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004853 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000016078 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000015999 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000009986 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000014261 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000005184 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000002614 | 17 retrocopies | |
| Tupaia belangeri | ENSTBEG00000007272 | 4 retrocopies |