RetrogeneDB ID: | retro_tbel_4419 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_81953:3915..4154(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EIF5A2 | ||
| Ensembl ID: | ENSTBEG00000000408 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation initiation factor 5A2 [Source:HGNC Symbol;Acc:3301] |
| Percent Identity: | 90.12 % |
| Parental protein coverage: | 51.95 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | STHNMDVPNIKRND-YQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVLCAMSE |
| S.HNMDVPNIKRND.YQLI.IQDGYLSLLTET.EVREDLKLPEGELG.EIEGKY..GED.QVSVLCAMSE | |
| Retrocopy | SQHNMDVPNIKRND<YQLIHIQDGYLSLLTETREVREDLKLPEGELGQEIEGKYSVGEDGQVSVLCAMSE |
| Parental | EHAVAVEPCKQ |
| EHAVAVEPCKQ | |
| Retrocopy | EHAVAVEPCKQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005363 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012594 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000014801 | 2 retrocopies | |
| Homo sapiens | ENSG00000163577 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000007473 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016657 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015621 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000008130 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000000408 | 2 retrocopies |
retro_tbel_1442, retro_tbel_4419 ,
|