RetrogeneDB ID: | retro_sscr_1206 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | X:83356026..83356353(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ZFAND6 | ||
| Ensembl ID: | ENSSSCG00000001779 | ||
| Aliases: | None | ||
| Description: | zinc finger, AN1-type domain 6 [Source:HGNC Symbol;Acc:30164] |
| Percent Identity: | 79.82 % |
| Parental protein coverage: | 52.15 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | QSTPVPNQSLLSESVASSQVDSTSVDKAIPETEDLQASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKK |
| Q..P..NQSLLS.SVASSQV.STSVDKAIPETEDLQ.SVSDTAQQPSEEQSKSL.......N.CFMCRKK | |
| Retrocopy | QPSPISNQSLLSQSVASSQVNSTSVDKAIPETEDLQPSVSDTAQQPSEEQSKSLXXXXXXXNCCFMCRKK |
| Parental | VGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIR |
| VG.TGF.C.CGNVY.GVHRYSD.HNCSYNYKAD.AEKI. | |
| Retrocopy | VGITGF*CWCGNVYYGVHRYSDEHNCSYNYKADTAEKIQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 32 .25 RPM |
| SRP014902_testis | 0 .00 RPM | 47 .81 RPM |
| SRP018288_heart | 0 .00 RPM | 48 .38 RPM |
| SRP018288_kidney | 0 .00 RPM | 128 .75 RPM |
| SRP018288_liver | 0 .00 RPM | 88 .91 RPM |
| SRP018288_lung | 0 .00 RPM | 31 .26 RPM |
| SRP018856_adipose | 0 .00 RPM | 36 .15 RPM |
| SRP035408_brain | 0 .00 RPM | 35 .83 RPM |
| SRP035408_liver | 0 .00 RPM | 58 .95 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000012321 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000009491 | 2 retrocopies | |
| Felis catus | ENSFCAG00000012931 | 2 retrocopies | |
| Homo sapiens | ENSG00000086666 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015621 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000006722 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019428 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008870 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007361 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000013506 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000001779 | 2 retrocopies |
retro_sscr_1206 , retro_sscr_1207,
|