RetrogeneDB ID: | retro_shar_744 | ||
Retrocopy location | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
| Coordinates: | GL861697.1:2273481..2273636(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSSHAG00000006433 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 65.45 % |
| Parental protein coverage: | 65.06 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MNFFQF-LMKKKELIPLIAFVSIAGSGAAYMATYSFFKSDVIVNRWQNPEPWENV |
| MN.F.F.LMKKKEL.PLI.FVSIAG.GA.....Y..FK.DVIVNR..NPE..E.V | |
| Retrocopy | MNLFDF<LMKKKELLPLITFVSIAGTGAVFI--YFLFKTDVIVNRKKNPEL*ESV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000031501 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000020706 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000003556 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000028279 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000029216 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000050251 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000006433 | 3 retrocopies |
retro_shar_296, retro_shar_416, retro_shar_744 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000021929 | 1 retrocopy |