RetrogeneDB ID: | retro_eeur_594 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_356469:2355..2604(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C15orf48 | ||
| Ensembl ID: | ENSEEUG00000003556 | ||
| Aliases: | None | ||
| Description: | chromosome 15 open reading frame 48 [Source:HGNC Symbol;Acc:29898] |
| Percent Identity: | 98.8 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MNLFQLLMKKKELIPLVLIMTTAAGGASSFAVYSLSKSDV-IDRKNNPEPWENVDLNVPQKLITINQQWK |
| MNLFQLLMKKKELIPLVLIMTTAAGGASSFAVYSLSKSDV.IDRKNNPEPWENVDLNVPQKLITINQQWK | |
| Retrocopy | MNLFQLLMKKKELIPLVLIMTTAAGGASSFAVYSLSKSDVIIDRKNNPEPWENVDLNVPQKLITINQQWK |
| Parental | PIEELQKVRRATK |
| PIEELQKVRRATK | |
| Retrocopy | PIEELQKVRRATK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .64 RPM | 0 .32 RPM |
| SRP017611_kidney | 1 .69 RPM | 0 .75 RPM |
| SRP017611_liver | 0 .16 RPM | 0 .32 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000031501 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000020706 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000003556 | 1 retrocopy |
retro_eeur_594 ,
|
| Macropus eugenii | ENSMEUG00000013137 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000028279 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000029216 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000050251 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000006433 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000021929 | 1 retrocopy |